PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011079486.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 986aa    MW: 109946 Da    PI: 6.13
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011079486.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.33.3e-41145222178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C adls+ak+yhrrhkvCe+hska+++lv++++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+q+
  XP_011079486.1 145 VCQVDDCGADLSKAKDYHRRHKVCEMHSKASKALVANQMQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTQT 222
                     6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.6E-34141207IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.103143220IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-38144225IPR004333Transcription factor, SBP-box
PfamPF031104.2E-30146219IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.98E-7745874IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.3E-5763879IPR020683Ankyrin repeat-containing domain
CDDcd002049.14E-7764874No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 986 aa     Download sequence    Send to blast
MEEARFGAQP QLYYGMPSTD LRAMAKRGIE WDPNDWRWDG DLFIATPLHP TSSNFQSRQL  60
FPLQTQLTTT VASSNSCSSF SDELDQPTVK DNRELEKKRR VQDNNLSADN LTLNLGGRGY  120
AVSANTEPTT GKKTKLAAPT PNRAVCQVDD CGADLSKAKD YHRRHKVCEM HSKASKALVA  180
NQMQRFCQQC SRFHALQEFD EGKRSCRRRL AGHNKRRRKT QTENVSNSSP INDNQASGYL  240
LMSILKILSN MHSNRSNQTD DQDLLSHLLQ TLASQGPFRR NISAHLQESQ DLLNNLPSLG  300
NSESVPALLS NDSLGQRSMQ EHCTTTGDEM PRKIGDLQAS SQRPGIVLHT QATSQIYDQG  360
RETSGGRSKL NNFDLNDIYV DSDDGMDDIE RSTVPQGLGI GCPSWAQQES HQSSPPQTSG  420
NSDSASAQSP SSSSGEAQSH TDRIVFKLFG KEPSDFPIVL RAQIFDWLSH SPTDIESYIR  480
PGCVILTIYL RLSESSWEEL YCDLSSSLNR LLNIYDDVYF WSTGWIYARV QNQMAFVYNG  540
QVVVNTSLPL GTDNYTTILS VKPIAVASSG QAQFFVKGIN LSRPSTRLLC ALDGNYVEAS  600
TELVEHVDGL EGSVQYLKFS CSVPAVTGRG FIEVEDHGLS SSFFPFIVCE DDVCTEICML  660
EKEIELTDID NLHRGRFYAR NQAMEFIHEM GWLLHKLQSK LRFGHEGPNL GSFPFERFKY  720
LVEFSMDHDW CSVVNKLLDI LFYGIVSGGE QPFVKFALSE MGLLHRAVRR NSRSLVEMLL  780
RYVPEEVADE LSSEYQSLVE IDKSSLFRPD VAGPGGLTPL HVAAGRDGSE DILDALTDDP  840
GKVGIGAWKS ALDSTGFTPE DYARLRGHYS YIHLVQRKIN RRVSSGHVVV DISDTVSDSS  900
INQKPNMEPP ASFEIGIKGI QRPCGVCAQN MAYRTGSRTL LYRPAMLSML AIAAVCVCVA  960
ILMKSLPRVL FVFRPFSWEM LEYGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-311452191084squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079486.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A022S4J40.0A0A022S4J4_ERYGU; Uncharacterized protein
STRINGVIT_07s0005g02260.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1